Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN29 Rabbit Polyclonal Antibody (HRP)

ZSCAN29 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF690, Zfp690

UniProt

Q8IWY8

Immunogen

The immunogen for Anti-ZSCAN29 antibody is: synthetic peptide directed towards the middle region of Human ZSC29

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRPRSSVTVSVKGQEVRLEKMTPPKSSQELLSVRQESVEPQPRGVPKKER

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nutlin-3
SIH-344-5MG 5 mg

Nutlin-3

Sign In for Pricing
View Details
N-Hydroxy Metamizole EP Impurity C
TRC-M285610-50MG 50 mg

N-Hydroxy Metamizole EP Impurity C

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
Human AJM1 activation kit by CRISPRa
GA118079 1 Kit

Human AJM1 activation kit by CRISPRa

Sign In for Pricing
View Details