Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF3 Rabbit Polyclonal Antibody (HRP)

TCF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E2A, E47, p75, AGM8, ITF1, VDIR, TCF-3, bHLHb21

UniProt

P15923

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TCF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003191

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITPK1 (NM_001142593) Human Recombinant Protein
TP327205M 100 µg

ITPK1 (NM_001142593) Human Recombinant Protein

Sign In for Pricing
View Details
CYP2R1 siRNA (Human)
MBS8234411-01 15 nmol

CYP2R1 siRNA (Human)

Sign In for Pricing
View Details
CYP2R1 siRNA (Human)
MBS8234411-02 30 nmol

CYP2R1 siRNA (Human)

Sign In for Pricing
View Details
CYP2R1 siRNA (Human)
MBS8234411-03 5x 30 nmol

CYP2R1 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Trichodesmium erythraeum ATP synthase subunit b' (atpG)
orb2931045-01 20 µg

Recombinant Trichodesmium erythraeum ATP synthase subunit b' (atpG)

Sign In for Pricing
View Details
Recombinant Trichodesmium erythraeum ATP synthase subunit b' (atpG)
orb2931045-02 100 µg

Recombinant Trichodesmium erythraeum ATP synthase subunit b' (atpG)

Sign In for Pricing
View Details