Recombinant Trichodesmium erythraeum ATP synthase subunit b' (atpG)
This Recombinant Trichodesmium erythraeum ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-161.
Product Specifications
Product Name Alternative
ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'
UniProt
Q112Z3
Expression Region
1-161
Origin
Trichodesmium erythraeum (strain IMS101)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MINLTIVLAVEEVAEKGGLFDINATLPLMAIQFLLLAFVLDKIFYKPLGKAIDSRADYIR ENQVKAKERLAKAKQLAEQYEQEFAQTRQKSQVVIVAAQAEAEKIAATKVAVAQKEAQVK REQAAQEIEKQKEVALEQLEEQVDSLSRQILEKLLGPELVR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GAF-441-30 1 mL
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse IgG, Fc Specific, 30nm
Sign In for Pricing
View Details 
LC422656 20 µg
Pirin (PIR) (NM_001018109) Human Over-expression Lysate
Sign In for Pricing
View Details 