Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2B Rabbit Polyclonal Antibody (FITC)

TFAP2B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PDA2, AP-2B, AP2-B, AP-2beta

UniProt

Q92481

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003212

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF15 (E193) polyclonal antibody
BS2241-01 50 µL

RNF15 (E193) polyclonal antibody

Sign In for Pricing
View Details
RNF15 (E193) polyclonal antibody
BS2241-02 100 µL

RNF15 (E193) polyclonal antibody

Sign In for Pricing
View Details
Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit
E-MSEL-M0094-01 24 Tests

Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit
E-MSEL-M0094-02 48 Tests

Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit
E-MSEL-M0094-03 96 Tests

Mini Sample Mouse LAB7-1 (B-Lymphocyte Activation Antigen B7-1) ELISA Kit

Sign In for Pricing
View Details
ANAPC2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
11878126 3x 1.0µg DNA

ANAPC2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details