Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL1, Human (His)

The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N (7) -methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

METTL1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mettl1-protein-human-his.html

Purity

98.0

Smiles

DHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ

Molecular Formula

4234 (Gene_ID) Q9UBP6-1/NP_005362.3 (D32-Q265) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLGN1 AAV siRNA Pooled Vector
31894161 1.0 µg

NLGN1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rabbit anti-Nucleostemin Antibody
YLD5667-01 50 µL

Rabbit anti-Nucleostemin Antibody

Sign In for Pricing
View Details
Rabbit anti-Nucleostemin Antibody
YLD5667-02 100 µL

Rabbit anti-Nucleostemin Antibody

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 587B (ZNF587B)
MBS1172156-01 0.02 mg (E-Coli)

Recombinant Human Zinc finger protein 587B (ZNF587B)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 587B (ZNF587B)
MBS1172156-02 0.02 mg (Yeast)

Recombinant Human Zinc finger protein 587B (ZNF587B)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 587B (ZNF587B)
MBS1172156-03 0.1 mg (E-Coli)

Recombinant Human Zinc finger protein 587B (ZNF587B)

Sign In for Pricing
View Details