Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmo2 Rabbit Polyclonal Antibody (HRP)

Lmo2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rbt, Rbtn, Rhom, Ttg2, Rbtn2, Rbtn-2, Rhom-2

UniProt

A2BHP5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001135807

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Srrm3 Pre-designed siRNA Set A
SI213774A 1 Each

Rat Srrm3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
LONRF3, CT (LONRF3, RNF127, LON peptidase N-terminal domain and RING finger protein 3, RING finger protein 127) (MaxLight 550)
MBS6316731-01 0.1 mL

LONRF3, CT (LONRF3, RNF127, LON peptidase N-terminal domain and RING finger protein 3, RING finger protein 127) (MaxLight 550)

Sign In for Pricing
View Details
LONRF3, CT (LONRF3, RNF127, LON peptidase N-terminal domain and RING finger protein 3, RING finger protein 127) (MaxLight 550)
MBS6316731-02 5x 0.1 mL

LONRF3, CT (LONRF3, RNF127, LON peptidase N-terminal domain and RING finger protein 3, RING finger protein 127) (MaxLight 550)

Sign In for Pricing
View Details
ARSJ Peptide - C-terminal region
orb2006671 100 µg

ARSJ Peptide - C-terminal region

Sign In for Pricing
View Details
Staphylococcus aureus Alpha-toxin/hly Human Monoclonal Antibody
orb2960454-01 50 µg

Staphylococcus aureus Alpha-toxin/hly Human Monoclonal Antibody

Sign In for Pricing
View Details
Staphylococcus aureus Alpha-toxin/hly Human Monoclonal Antibody
orb2960454-02 100 µg

Staphylococcus aureus Alpha-toxin/hly Human Monoclonal Antibody

Sign In for Pricing
View Details