Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARSJ Peptide - C-terminal region

ARSJ Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ23548

UniProt

Q5FYB0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARSJ Rabbit Polyclonal Antibody (orb326630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078866

Preservative

Lyophilized powder

AA Sequence

VWGPWYKEETKKKKPSKNQAEKKQKKSKKKKKKQQKAVSGSTCHSGVTCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Suberanilic Acid
TRC-S688650-200MG 200 mg

Suberanilic Acid

Sign In for Pricing
View Details
Phaseolus vulgaris Gel -PHA-L- Immobilized Lectin
AK-1801-2 2 mL

Phaseolus vulgaris Gel -PHA-L- Immobilized Lectin

Sign In for Pricing
View Details
TIGIT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G9]
TA813035AM 100 µL

TIGIT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G9]

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR559576 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
HSP60 (GROEL/730), CF647 conjugate, 0.1mg/mL
BNC470730-100 1x 100 µL

HSP60 (GROEL/730), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMC5 Recombinant Rabbit monoclonal Antibody
HA751551 100 µL

SMC5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details