Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX5 Rabbit Polyclonal Antibody (FITC)

SSX5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

O60225

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SSX5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish LSG1 Antibody Picoband® Fluoro594 Conjugated
AZQ6NY89-Fluoro594 100 µg/Vial

Anti-Zebrafish LSG1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Porcine CUB and zona pellucida like domain containing protein 1 (CUZD1) ELISA kit
GTR10440499 96 Well

Porcine CUB and zona pellucida like domain containing protein 1 (CUZD1) ELISA kit

Sign In for Pricing
View Details
Rat Tumor necrosis factor β (TNF-β) ELISA Kit
YP-W31064-01 48 Tests

Rat Tumor necrosis factor β (TNF-β) ELISA Kit

Sign In for Pricing
View Details
Rat Tumor necrosis factor β (TNF-β) ELISA Kit
YP-W31064-02 96 Tests

Rat Tumor necrosis factor β (TNF-β) ELISA Kit

Sign In for Pricing
View Details
Zebrafish Alpha A Crystallin/CRYAA Rabbit Polyclonal Antibody (APC)
orb3130535 100 µg

Zebrafish Alpha A Crystallin/CRYAA Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
(S, R, S) -AHPC-Me-12- ((4-Bromobutyl) amino) dodecanamide
HY-168290 1 Each

(S, R, S) -AHPC-Me-12- ((4-Bromobutyl) amino) dodecanamide

Sign In for Pricing
View Details