Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rorb Rabbit Polyclonal Antibody (FITC)

Rorb Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

F1LQ88

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002725756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactivator CRSP70, ARC70, CRSP7) (MaxLight 650)
129543-ML650 100 µL

MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactivator CRSP70, ARC70, CRSP7) (MaxLight 650)

Sign In for Pricing
View Details
Dcun1d2 Rabbit Polyclonal Antibody
orb586977 100 µL

Dcun1d2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rebaudioside O
HY-N8009-01 1 mg

Rebaudioside O

Sign In for Pricing
View Details
Rebaudioside O
HY-N8009-02 5 mg

Rebaudioside O

Sign In for Pricing
View Details
Propyl Gallate EP Impurity A
KL-02-02071 100 mg

Propyl Gallate EP Impurity A

Sign In for Pricing
View Details
FA96B, NT (FAM96B, MIP18, Mitotic spindle-associated MMXD complex subunit MIP18, MSS19-interacting protein of 18kD, Protein FAM96B) (MaxLight 750)
MBS6297546-01 0.1 mL

FA96B, NT (FAM96B, MIP18, Mitotic spindle-associated MMXD complex subunit MIP18, MSS19-interacting protein of 18kD, Protein FAM96B) (MaxLight 750)

Sign In for Pricing
View Details