Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zbtb43 Rabbit Polyclonal Antibody (Biotin)

Zbtb43 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Zfp297, Zfp297b, mKIAA0414, 1700010E06Rik

UniProt

Q9DAI4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082223

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r34 ORF Vector (Rat) (pORF)
ORF078942 1.0 µg DNA

Vom2r34 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
HLA-DQA1, Recombinant, Human, aa24-213, His-Tag (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain)
373643-01 20 µg

HLA-DQA1, Recombinant, Human, aa24-213, His-Tag (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain)

Sign In for Pricing
View Details
HLA-DQA1, Recombinant, Human, aa24-213, His-Tag (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain)
373643-02 100 µg

HLA-DQA1, Recombinant, Human, aa24-213, His-Tag (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain)

Sign In for Pricing
View Details
HLA-DQA1, Recombinant, Human, aa24-213, His-Tag (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain)
373643-03 1 mg

HLA-DQA1, Recombinant, Human, aa24-213, His-Tag (HLA Class II Histocompatibility Antigen, DQ alpha 1 Chain)

Sign In for Pricing
View Details
2- (Ethylthio) pyridine-5-boronic acid
OR360486 1 Each

2- (Ethylthio) pyridine-5-boronic acid

Sign In for Pricing
View Details
Mouse CD80/B7-1 PicoKine® Quick ELISA Kit
FEK0708 96 Well With Removable Strips

Mouse CD80/B7-1 PicoKine® Quick ELISA Kit

Sign In for Pricing
View Details