Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX6 Rabbit Polyclonal Antibody (HRP)

CBX6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O95503

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CBX6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQK

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_055107

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC37 Antibody (Biotin)
orb151598 100 µg

CDC37 Antibody (Biotin)

Sign In for Pricing
View Details
OVA Conjugated Hyaluronic Acid (HA)
RPU50588-01 50 µg

OVA Conjugated Hyaluronic Acid (HA)

Sign In for Pricing
View Details
OVA Conjugated Hyaluronic Acid (HA)
RPU50588-02 100 µg

OVA Conjugated Hyaluronic Acid (HA)

Sign In for Pricing
View Details
OVA Conjugated Hyaluronic Acid (HA)
RPU50588-03 1 mg

OVA Conjugated Hyaluronic Acid (HA)

Sign In for Pricing
View Details
Goat F-box only protein 32 (FBXO32) ELISA Kit
GTR10479016-01 48 Well

Goat F-box only protein 32 (FBXO32) ELISA Kit

Sign In for Pricing
View Details
Goat F-box only protein 32 (FBXO32) ELISA Kit
GTR10479016-02 96 Well

Goat F-box only protein 32 (FBXO32) ELISA Kit

Sign In for Pricing
View Details