Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1B2, Human (His)

EEF1B2 Protein facilitates GDP-to-GTP exchange on EEF1A Protein, driving the conversion. EEF1 comprises four subunits: alpha, beta, delta, and gamma. EEF1B2 Protein, Human (His) is the recombinant human-derived EEF1B2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EEF1B2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eef1b2-protein-human-his.html

Purity

94.20

Smiles

GFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

Molecular Formula

1933 (Gene_ID) P24534 (G2-I225) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATP binding cassette sub family A member 5 (ABCA5) ELISA Kit
GTR10347203 96 Well

Human ATP binding cassette sub family A member 5 (ABCA5) ELISA Kit

Sign In for Pricing
View Details
(±) 13,14-EDT
T83868-01 25 µg

(±) 13,14-EDT

Sign In for Pricing
View Details
(±) 13,14-EDT
T83868-02 50 µg

(±) 13,14-EDT

Sign In for Pricing
View Details
(±) 13,14-EDT
T83868-03 100 µg

(±) 13,14-EDT

Sign In for Pricing
View Details
(±) 13,14-EDT
T83868-04 500 µg

(±) 13,14-EDT

Sign In for Pricing
View Details
Cat Cross linked C-telopeptide of type 1 collagen,CTX-1 ELISA KIT
JOT-EK0005Cat-01 96 Well

Cat Cross linked C-telopeptide of type 1 collagen,CTX-1 ELISA KIT

Sign In for Pricing
View Details