Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIX4 Rabbit Polyclonal Antibody (HRP)

SIX4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AREC3

UniProt

Q9UIU6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SIX4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSSSSPTGQIASAADIKQENGMESASEGQEAHREVAGGAAVGLSPPAPAP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_059116

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Histone H2A type 2-A (H2AC18)
CSB-EP738883HU-01 20 µg

Recombinant Human Histone H2A type 2-A (H2AC18)

Sign In for Pricing
View Details
Recombinant Human Histone H2A type 2-A (H2AC18)
CSB-EP738883HU-02 100 µg

Recombinant Human Histone H2A type 2-A (H2AC18)

Sign In for Pricing
View Details
Recombinant Human Histone H2A type 2-A (H2AC18)
CSB-EP738883HU-03 1 mg

Recombinant Human Histone H2A type 2-A (H2AC18)

Sign In for Pricing
View Details
Canine TNF Receptor Associated Factor 2 (TRAF2) ELISA Kit
MBS9926975-01 48 Well

Canine TNF Receptor Associated Factor 2 (TRAF2) ELISA Kit

Sign In for Pricing
View Details
Canine TNF Receptor Associated Factor 2 (TRAF2) ELISA Kit
MBS9926975-02 96 Well

Canine TNF Receptor Associated Factor 2 (TRAF2) ELISA Kit

Sign In for Pricing
View Details
Canine TNF Receptor Associated Factor 2 (TRAF2) ELISA Kit
MBS9926975-03 5x 96 Well

Canine TNF Receptor Associated Factor 2 (TRAF2) ELISA Kit

Sign In for Pricing
View Details