Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2A type 2-A (H2AC18)

Product Specifications

Product Name Alternative

H2A-clustered histone 18; H2A-clustered histone 19; Histone H2A.2

Abbreviation

Recombinant Human H2AC18 protein

Gene Name

H2AC18

UniProt

Q6FI13

Expression Region

2-130aa

Organism

Homo sapiens (Human)

Target Sequence

SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5-Bis(chlorosulfonyl)benzoic Acid
TRC-B218290-1G 1 g

3,5-Bis(chlorosulfonyl)benzoic Acid

Sign In for Pricing
View Details
DuoClick™ Screw-Cap Culture Tubes
T8742 500 Units/Case

DuoClick™ Screw-Cap Culture Tubes

Sign In for Pricing
View Details
TentaGel® MB NH₂
MB160002.25G 25 g

TentaGel® MB NH₂

Sign In for Pricing
View Details
Matr3 Mouse Gene Knockout Kit (CRISPR)
KN309822LP 1 Kit

Matr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (LAMP4/1830), Biotin conjugate, 0.1mg/mL
BNCB1830-100 1x 100 µL

CD68 (Macrophage Marker) (LAMP4/1830), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TEPSIN activation kit by CRISPRa
GA115571 1 Kit

Human TEPSIN activation kit by CRISPRa

Sign In for Pricing
View Details