Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gatad2b Rabbit Polyclonal Antibody (HRP)

Gatad2b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P66be, P66beta, AL118180, mKIAA1150, C430014D17Rik

UniProt

Q8VHR5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSNFAQAPQLSVPGGLLGMPGVNIAYLNTGIGGHKAPSLADRQREYLLDM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_647465

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Micro Erythromycin-N-methylenzyme Assay Kit
OM626089 100 Tests

Micro Erythromycin-N-methylenzyme Assay Kit

Sign In for Pricing
View Details
CNDP2 Peptide - C-terminal region
orb1998490 100 µg

CNDP2 Peptide - C-terminal region

Sign In for Pricing
View Details
Calcyon (CALY) Human Over-expression Lysate
orb1368951 20 µg

Calcyon (CALY) Human Over-expression Lysate

Sign In for Pricing
View Details
Gm13251 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
21800124 3x 1.0µg DNA

Gm13251 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
CTNNA3 Rabbit pAb (APR23113N)
APR23113N-01 50 µL

CTNNA3 Rabbit pAb (APR23113N)

Sign In for Pricing
View Details
CTNNA3 Rabbit pAb (APR23113N)
APR23113N-02 100 µL

CTNNA3 Rabbit pAb (APR23113N)

Sign In for Pricing
View Details