Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNDP2 Peptide - C-terminal region

CNDP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CN2, CPGL, PEPA, HsT2298, HEL-S-13

UniProt

Q96KP4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001161971.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EATGKNVMLLPVGSADDGAHSQNEKLNRYNYIEGTKMLAAYLYEVSQLKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cybrd1 qPCR Primer Pair
QM42138S 200 Tests

Mouse Cybrd1 qPCR Primer Pair

Sign In for Pricing
View Details
ANKIB1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0087207 1.0 µg DNA

ANKIB1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Anti Human CD52: RPE
MBS225808-01 100 Tests

Mouse Anti Human CD52: RPE

Sign In for Pricing
View Details
Mouse Anti Human CD52: RPE
MBS225808-02 5x 100 Tests

Mouse Anti Human CD52: RPE

Sign In for Pricing
View Details
AQP8 Antibody
orb253162 100 µL

AQP8 Antibody

Sign In for Pricing
View Details
Lentiviral human CRHBP shRNA (UAS) - Lentiviral human CRHBP shRNA (UAS, GFP) (25)
GTR15154460 1 Vial

Lentiviral human CRHBP shRNA (UAS) - Lentiviral human CRHBP shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details