Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDF1 Rabbit Polyclonal Antibody (HRP)

EDF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MBF1, EDF-1, CFAP280

UniProt

O60869

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human EDF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_694880

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTF2 Peptide - N-terminal region
orb2001829 100 µg

TTF2 Peptide - N-terminal region

Sign In for Pricing
View Details
CD82 Antibody (YA3925, Mouse)
HY-P84228-01 10 µL

CD82 Antibody (YA3925, Mouse)

Sign In for Pricing
View Details
CD82 Antibody (YA3925, Mouse)
HY-P84228-02 50 μL

CD82 Antibody (YA3925, Mouse)

Sign In for Pricing
View Details
CD82 Antibody (YA3925, Mouse)
HY-P84228-03 100 µL

CD82 Antibody (YA3925, Mouse)

Sign In for Pricing
View Details
Ubiquitin (PE) discontinued
171795-PE 100 µL

Ubiquitin (PE) discontinued

Sign In for Pricing
View Details
Lentiviral human ROCK1 shRNA (UAS) - Lentiviral human ROCK1 shRNA (UAS, GFP) (100)
GTR15113133 1 Vial

Lentiviral human ROCK1 shRNA (UAS) - Lentiviral human ROCK1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details