Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTF2 Peptide - N-terminal region

TTF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TTF2

UniProt

Q9UNY4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTF2 Rabbit Polyclonal Antibody (orb588452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ntn1 activation kit by CRISPRa
GA202984 1 Kit

Mouse Ntn1 activation kit by CRISPRa

Sign In for Pricing
View Details
CTBP1 Polyclonal Antibody
E-AB-67568-01 60 µL

CTBP1 Polyclonal Antibody

Sign In for Pricing
View Details
CTBP1 Polyclonal Antibody
E-AB-67568-02 120 µL

CTBP1 Polyclonal Antibody

Sign In for Pricing
View Details
CTBP1 Polyclonal Antibody
E-AB-67568-03 200 µL

CTBP1 Polyclonal Antibody

Sign In for Pricing
View Details
TPD52L3 Polyclonal Antibody
E-AB-65358-01 60 µL

TPD52L3 Polyclonal Antibody

Sign In for Pricing
View Details
TPD52L3 Polyclonal Antibody
E-AB-65358-02 120 µL

TPD52L3 Polyclonal Antibody

Sign In for Pricing
View Details