Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF25 Rabbit Polyclonal Antibody (FITC)

ZNF25 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Zfp9, KOX19

UniProt

P17030

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF25

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EKPYACKECGKSFSQKSHFIIHQRKHTGEKPYECQECGETFIQKSQLTAH

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

CAD38845

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Innovative Grade US Origin Bovine Calf Testicle Untrimmed Fresh in PBS
IGCLFTSTPT2 1 Each

Innovative Grade US Origin Bovine Calf Testicle Untrimmed Fresh in PBS

Sign In for Pricing
View Details
c Abl (ABL1) Human siRNA Oligo Duplex (Locus ID 25)
SR319232 1 Kit

c Abl (ABL1) Human siRNA Oligo Duplex (Locus ID 25)

Sign In for Pricing
View Details
PIR Antibody
27-915 100 µL

PIR Antibody

Sign In for Pricing
View Details
Easypro Human Procollagen II N-Terminal Propeptide (PIINP) ELISA Kit
FY-EH2968S 96 Well

Easypro Human Procollagen II N-Terminal Propeptide (PIINP) ELISA Kit

Sign In for Pricing
View Details
Goat Anti-Human IgA Antibody (H+L), Cy7 Conjugated
bs-0360G-Cy7 200 µL

Goat Anti-Human IgA Antibody (H+L), Cy7 Conjugated

Sign In for Pricing
View Details
TAP2, CT (Antigen Peptide Transporter 2, APT2, Peptide Transporter TAP2, ATP-Binding Cassette Sub-family B Member 3, Peptide Supply Factor 2, Peptide Transporter PSF2, PSF-2, Peptide Transporter Involved In Antigen Processing 2, Really Interesting New Gene 11 Protein, ABCB3, PSF2, RING11, Y1) (MaxLight 750) discontinued
T8266-06-ML750 100 µL

TAP2, CT (Antigen Peptide Transporter 2, APT2, Peptide Transporter TAP2, ATP-Binding Cassette Sub-family B Member 3, Peptide Supply Factor 2, Peptide Transporter PSF2, PSF-2, Peptide Transporter Involved In Antigen Processing 2, Really Interesting New Gene 11 Protein, ABCB3, PSF2, RING11, Y1) (MaxLight 750) discontinued

Sign In for Pricing
View Details