Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN29 Rabbit Polyclonal Antibody (HRP)

ZSCAN29 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF690, Zfp690

UniProt

Q8IWY8

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence KSALRENGTNSETFRQRFRRFHYQEVAGPREAFSQLWELCCRWLRPEVRT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSALRENGTNSETFRQRFRRFHYQEVAGPREAFSQLWELCCRWLRPEVRT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_689668

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Conjugated Bovine Serum Albumin Rabbit mAb
C59309 100 µL

Conjugated Bovine Serum Albumin Rabbit mAb

Sign In for Pricing
View Details
Rat Cathepsin K (CTSK) ELISA Kit
RD-CTSK-Ra-01 96 Tests

Rat Cathepsin K (CTSK) ELISA Kit

Sign In for Pricing
View Details
Rat Cathepsin K (CTSK) ELISA Kit
RD-CTSK-Ra-02 48 Tests

Rat Cathepsin K (CTSK) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal TIMM17B Antibody [Janelia Fluor 646]
NBP2-98507JF646 0.1 mL

Rabbit Polyclonal TIMM17B Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
MOB4 Adenovirus (Rat)
30283056 1.0 mL

MOB4 Adenovirus (Rat)

Sign In for Pricing
View Details
WASL rabbit pAb
ES11262-01 50 µL

WASL rabbit pAb

Sign In for Pricing
View Details