Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF527 Rabbit Polyclonal Antibody (HRP)

ZNF527 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF527

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKAFHQILSLRLHQRIHAGEKPYKCNECGNNFSCVSALRRHQRIHNRETL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_030378

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFF1 Antibody
orb1252701 100 µg

TFF1 Antibody

Sign In for Pricing
View Details
Recombinant Human MYOZ1 Protein, N-His-SUMO
MBS1577267-01 0.1 mg

Recombinant Human MYOZ1 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human MYOZ1 Protein, N-His-SUMO
MBS1577267-02 1 mg

Recombinant Human MYOZ1 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human MYOZ1 Protein, N-His-SUMO
MBS1577267-03 5x 1 mg

Recombinant Human MYOZ1 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human CGB3 Protein, N-His
orb2836512-01 20 µg

Recombinant Human CGB3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CGB3 Protein, N-His
orb2836512-02 50 µg

Recombinant Human CGB3 Protein, N-His

Sign In for Pricing
View Details