Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2S1 Rabbit Polyclonal Antibody (HRP)

EIF2S1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIF2, EIF-2, EIF2A, EIF-2A, EIF-2alpha

UniProt

P05198

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human EIF2S1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_004085

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PPP1R7 Antibody (OTI4F9) [DyLight 488]
NBP2-73586G 0.1 mL

Mouse Monoclonal PPP1R7 Antibody (OTI4F9) [DyLight 488]

Sign In for Pricing
View Details
UNC5C ELISA Kit (Chicken)
OKEH08676-96W 96 Well

UNC5C ELISA Kit (Chicken)

Sign In for Pricing
View Details
Mouse ECM1 ELISA Kit PicoKine
MBS1759865-01 96 Well

Mouse ECM1 ELISA Kit PicoKine

Sign In for Pricing
View Details
Mouse ECM1 ELISA Kit PicoKine
MBS1759865-02 5x 96 Well

Mouse ECM1 ELISA Kit PicoKine

Sign In for Pricing
View Details
TGF-beta 3 Rabbit Polyclonal Antibody (BF350)
orb1813051 100 µL

TGF-beta 3 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
CLLU1OS-set siRNA/shRNA/RNAi Lentivector (Human)
16357091 4x 500 ng

CLLU1OS-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details