H2BC11, Human
The H2BC11 protein functions as a core component of nucleosomes, the fundamental units in chromatin structure that wrap and compact DNA, regulating its accessibility to cellular processes that require DNA as a template. Histones, including H2BC11, play central roles in transcriptional regulation, DNA repair, DNA replication, and chromosome stability. H2BC11 Protein, Human is the recombinant human-derived H2BC11 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
H2BC11 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/h2bc11-protein-human.html
Smiles
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Molecular Formula
8970 (Gene_ID) P06899 (P2-K126) (Accession)
Molecular Weight
Approximately 13.8 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
RGD1562665 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)