Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBPMS2 Rabbit Polyclonal Antibody (FITC)

RBPMS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6ZRY4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBPMS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ANTKMAKSKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_919248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stromal Cell Derived Factor 1 (SDF1) Magnetic Fluorescence Assay Kit
MBS2154879-01 96 Tests

Stromal Cell Derived Factor 1 (SDF1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Stromal Cell Derived Factor 1 (SDF1) Magnetic Fluorescence Assay Kit
MBS2154879-02 5x 96 Tests

Stromal Cell Derived Factor 1 (SDF1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Stromal Cell Derived Factor 1 (SDF1) Magnetic Fluorescence Assay Kit
MBS2154879-03 10x 96 Tests

Stromal Cell Derived Factor 1 (SDF1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Anti-HSD17B2 Antibody Picoband® (Dylight488 Conjugate)
PA1604-Dylight488 100 µg

Anti-HSD17B2 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
TUBA1C Protein Vector (Human) (pPM-C-His)
PV044556 500 ng

TUBA1C Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Influenza A virus Matrix protein 2 (M)
orb2935498-01 20 µg

Recombinant Influenza A virus Matrix protein 2 (M)

Sign In for Pricing
View Details