Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P05778

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Weybridge H7N7) (Influenza A virus (strain A/FPV/Weybridge H7N7) )

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECSCSDSSDPLVIAASIIGILHFILWILDRLFFKCIYRRLKYGLK RGPSTEGVPKSMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNL1 Rabbit Polyclonal Antibody
AP06277PU-N 100 µg

CCNL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WDR79 (WRAP53) (NM_001143992) Human Recombinant Protein
TP327786L 1 mg

WDR79 (WRAP53) (NM_001143992) Human Recombinant Protein

Sign In for Pricing
View Details
mGluR6 Rabbit Polyclonal Antibody
HA500158 100 µL

mGluR6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Tspan2 activation kit by CRISPRa
GA208607 1 Kit

Mouse Tspan2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human VRK1 Protein (His & GST Tag)
PKSH031091 50 µg

Recombinant Human VRK1 Protein (His & GST Tag)

Sign In for Pricing
View Details
Snrpb2 Mouse Gene Knockout Kit (CRISPR)
KN516403 1 Kit

Snrpb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details