Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FZD10 Rabbit Polyclonal Antibody (FITC)

FZD10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fz10, FzE7, CD350, FZ-10, hFz10

UniProt

Q9ULW2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FZD10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIS Lite™ Cy3 Tris NTA Chelator
12660-AAT 100 µg

HIS Lite™ Cy3 Tris NTA Chelator

Sign In for Pricing
View Details
ZNF248 Rabbit Polyclonal Antibody
TA383536 100 µL

ZNF248 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WTAP Mouse Monoclonal Antibody [Clone ID: OTI6H3]
CF808316 100 µg

WTAP Mouse Monoclonal Antibody [Clone ID: OTI6H3]

Sign In for Pricing
View Details
Human LENG1 activation kit by CRISPRa
GA112396 1 Kit

Human LENG1 activation kit by CRISPRa

Sign In for Pricing
View Details
PAM16 Human Gene Knockout Kit (CRISPR)
KN402828 1 Kit

PAM16 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-Mouse CD49d (PS/2) In Vivo Antibody - Low Endotoxin
ICH1200-100mg 100 mg

Anti-Mouse CD49d (PS/2) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details