Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G5 Rabbit Polyclonal Antibody (HRP)

PLA2G5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FRFB, GV-PLA2, PLA2-10, hVPLA (2)

UniProt

P39877

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PLA2G5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SMN2 Antibody
NBP2-94596-0.02mL 0.02 mL

Rabbit Polyclonal SMN2 Antibody

Sign In for Pricing
View Details
Ifna14 3'UTR Luciferase Stable Cell Line
TU109923 1.0 mL

Ifna14 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Streptococcus Agalactiae gbs1633 Protein (aa 1-81)
VAng-Cr7494-500gEcoli 500 µg (E. coli)

Recombinant Streptococcus Agalactiae gbs1633 Protein (aa 1-81)

Sign In for Pricing
View Details
HEXDC CRISPR/Cas9 KO Plasmid (h)
sc-415348 20 µg

HEXDC CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
MICA, Human (HEK293, His-Avi)
HY-P77997 1 Each

MICA, Human (HEK293, His-Avi)

Sign In for Pricing
View Details
NFRκB CRISPR Activation Plasmid (m2)
sc-433432-ACT-2 20 µg

NFRκB CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details