Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adh7 Rabbit Polyclonal Antibody (Biotin)

Adh7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Adh, Adh-, Adh3, Adh4, Adt-, Adh-3, Adh3-, Adt-1, Adh-3e, Adh-3t, Adh3-e, Adh3-t, AI325182

UniProt

Q64437

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Adh7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_033756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Theaflavin-3-gallate (Standard)
HY-N0245R 1 Each

Theaflavin-3-gallate (Standard)

Sign In for Pricing
View Details
Lentiviral mouse Ei24 shRNA (UAS) - Lentiviral mouseEi24 shRNA (UAS, GFP) (25)
GTR15122816 1 Vial

Lentiviral mouse Ei24 shRNA (UAS) - Lentiviral mouseEi24 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
DIAPH2 (NM_006729) Human Over-expression Lysate
LS001730-100ug 100 µg

DIAPH2 (NM_006729) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human SEMA7A sgRNA gene knockout kit - Lentiviral human SEMA7A sgRNA gene knockout kit (plasmid)
GTR15379985 1 Vial

Lentiviral human SEMA7A sgRNA gene knockout kit - Lentiviral human SEMA7A sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Histone H2A.X (Phospho-Tyr142) Rabbit Polyclonal Antibody
orb251713 100 µL

Histone H2A.X (Phospho-Tyr142) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Type II Collagen CB8 Fragment
9060 0.5 mg

Mouse Type II Collagen CB8 Fragment

Sign In for Pricing
View Details