Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHODH Rabbit Polyclonal Antibody (FITC)

DHODH Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

URA1, POADS, DHOdehase

UniProt

Q02127

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DHODH

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001352

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), CF488A conjugate, 0.1mg/mL
BNC881863-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (JCB117), CF488A conjugate, 0.1mg/mL
BNC880476-100 1x 100 µL

CD79a (JCB117), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (Mesenchymal Cell Marker) (VIM/1937R), CF647 conjugate, 0.1mg/mL
BNC471937-500 1x 500 µL

Vimentin (Mesenchymal Cell Marker) (VIM/1937R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF568 conjugate, 0.1mg/mL
BNC681959-500 1x 500 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Annexin A1 Polyclonal Antibody
AN007180L-01 25 µL

Annexin A1 Polyclonal Antibody

Sign In for Pricing
View Details