Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC38A3 Rabbit Polyclonal Antibody (HRP)

SLC38A3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G17, SN1, NAT1, SNAT3

UniProt

Q99624

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_006832

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin (Mitochondrial Marker) (PHB/1881), Biotin conjugate, 0.1mg/mL
BNCB1881-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/1881), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human MECP2 Protein (His Tag)
PKSH032751-01 10 µg

Recombinant Human MECP2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MECP2 Protein (His Tag)
PKSH032751-02 50 µg

Recombinant Human MECP2 Protein (His Tag)

Sign In for Pricing
View Details
c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: PL14]
AM26688AG-N 200 µg

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: PL14]

Sign In for Pricing
View Details
Tissue FFPE Sections, Smooth muscle
CS700734 5x 5 µm

Tissue FFPE Sections, Smooth muscle

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF740 conjugate, 0.1mg/mL
BNC741295-100 1x 100 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details