Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN2 Rabbit Polyclonal Antibody (HRP)

CLDN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OAZON

UniProt

P57739

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLDN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_065117

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC14, ID (TBC1D14, KIAA1322, TBC1 domain family member 14) (MaxLight 550)
MBS6353816-01 0.1 mL

TBC14, ID (TBC1D14, KIAA1322, TBC1 domain family member 14) (MaxLight 550)

Sign In for Pricing
View Details
TBC14, ID (TBC1D14, KIAA1322, TBC1 domain family member 14) (MaxLight 550)
MBS6353816-02 5x 0.1 mL

TBC14, ID (TBC1D14, KIAA1322, TBC1 domain family member 14) (MaxLight 550)

Sign In for Pricing
View Details
DPP7 (DPP2, QPP) discontinued
508896 100 µg

DPP7 (DPP2, QPP) discontinued

Sign In for Pricing
View Details
SLC7A6 Peptide - N-terminal region
orb2000222 100 µg

SLC7A6 Peptide - N-terminal region

Sign In for Pricing
View Details
KRTAP5-1 Protein Vector (Human) (pPB-C-His)
PV090194 500 ng

KRTAP5-1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Hamster Early Growth Response Protein 2 ELISA Kit
MBS019765-01 48 Well

Hamster Early Growth Response Protein 2 ELISA Kit

Sign In for Pricing
View Details