Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A6 Peptide - N-terminal region

SLC7A6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LAT3, LAT-2, y+LAT-2

UniProt

Q92536

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC7A6 Rabbit Polyclonal Antibody (orb589519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001070253.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFT2D3 Protein Vector (Human) (pPM-C-His)
PV037796 500 ng

SFT2D3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) Antibody Pair Kit (with Standard)
MBS2102494-01 5x 96 Tests

Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) Antibody Pair Kit (with Standard)
MBS2102494-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) Antibody Pair Kit (with Standard)
MBS2102494-03 10x 96 Tests

Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) Antibody Pair Kit (with Standard)
MBS2102494-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Myosin Heavy Chain 4, Skeletal Muscle (MYH4) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Recombinant Human Placenta growth factor (PGF)
orb2985959-01 20 µg

Recombinant Human Placenta growth factor (PGF)

Sign In for Pricing
View Details