Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Placenta growth factor (PGF)

This Recombinant Human Placenta growth factor (PGF) spans the amino acid sequence from region 19-149aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PlGF; PGFL, PLGF

UniProt

P49763

Expression Region

19-149aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PWP1 Antibody
E310614 200 µL

PWP1 Antibody

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae rpsC Protein (aa 1-230) (strain NCCP11945)
VAng-Wyb2367-500gEcoli 500 µg (E. coli)

Recombinant Neisseria Gonorrhoeae rpsC Protein (aa 1-230) (strain NCCP11945)

Sign In for Pricing
View Details
Rat MX1 (Myxovirus Resistance 1) ELISA Kit
EK247635 96 Well

Rat MX1 (Myxovirus Resistance 1) ELISA Kit

Sign In for Pricing
View Details
N- (p-Chlorobenzoyl) -p-anisidine
TYD-00933-01 100 mg

N- (p-Chlorobenzoyl) -p-anisidine

Sign In for Pricing
View Details
N- (p-Chlorobenzoyl) -p-anisidine
TYD-00933-02 250 mg

N- (p-Chlorobenzoyl) -p-anisidine

Sign In for Pricing
View Details
N- (p-Chlorobenzoyl) -p-anisidine
TYD-00933-03 50 mg

N- (p-Chlorobenzoyl) -p-anisidine

Sign In for Pricing
View Details