Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TJAP1 Rabbit Polyclonal Antibody (HRP)

TJAP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PILT, TJP4

UniProt

Q5JTD0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TJAP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAX04198

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STUB1, CT (STUB1, CHIP, E3 ubiquitin-protein ligase CHIP, Antigen NY-CO-7, CLL-associated antigen KW-8, Carboxy terminus of Hsp70-interacting protein, STIP1 homology and U box-containing protein 1) (Azide free) (HRP)
MBS6352251-01 0.2 mL

STUB1, CT (STUB1, CHIP, E3 ubiquitin-protein ligase CHIP, Antigen NY-CO-7, CLL-associated antigen KW-8, Carboxy terminus of Hsp70-interacting protein, STIP1 homology and U box-containing protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
STUB1, CT (STUB1, CHIP, E3 ubiquitin-protein ligase CHIP, Antigen NY-CO-7, CLL-associated antigen KW-8, Carboxy terminus of Hsp70-interacting protein, STIP1 homology and U box-containing protein 1) (Azide free) (HRP)
MBS6352251-02 5x 0.2 mL

STUB1, CT (STUB1, CHIP, E3 ubiquitin-protein ligase CHIP, Antigen NY-CO-7, CLL-associated antigen KW-8, Carboxy terminus of Hsp70-interacting protein, STIP1 homology and U box-containing protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
Human Defensin Beta 103B (DEFb103B) ELISA Kit
YP-W18394-01 48 Tests

Human Defensin Beta 103B (DEFb103B) ELISA Kit

Sign In for Pricing
View Details
Human Defensin Beta 103B (DEFb103B) ELISA Kit
YP-W18394-02 96 Tests

Human Defensin Beta 103B (DEFb103B) ELISA Kit

Sign In for Pricing
View Details
Pex2 Peptide - C-terminal region
orb2009563 100 µg

Pex2 Peptide - C-terminal region

Sign In for Pricing
View Details
BOLL (Bol, Boule-like (Drosophila) ) (Biotin)
243851-Biotin 100 µL

BOLL (Bol, Boule-like (Drosophila) ) (Biotin)

Sign In for Pricing
View Details