Pex2 Peptide - C-terminal region
Pex2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
1700016J08Rik, PXR2, Pex2, TRIP8b
UniProt
Q8C437
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pex2 Rabbit Polyclonal Antibody (orb583374) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067458
Preservative
Lyophilized powder
AA Sequence
QRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
036004-FITC 200 µL
GFOD2, NT (GFOD2, Glucose-fructose oxidoreductase domain-containing protein 2) (FITC) discontinued
Sign In for Pricing
View Details 
MBS8115758-01 0.3 mg
Influenza A H1N1 (A/Texas/05/2009) Hemagglutinin (HA1 Subunit) HEK293 Cell Lysate (WB positive control)
Sign In for Pricing
View Details MBS8115758-02 5x 0.3 mg
Influenza A H1N1 (A/Texas/05/2009) Hemagglutinin (HA1 Subunit) HEK293 Cell Lysate (WB positive control)
Sign In for Pricing
View Details A00871-Biotin 100 µg/Vial
Anti-PF4 Antibody Picoband® (Biotine Conjugate)
Sign In for Pricing
View Details