Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rffl Rabbit Polyclonal Antibody (FITC)

Rffl Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ca, fr, Car, rif, Carp2, BG080975, 1700051E09Rik, 4930516L10Rik

UniProt

Q3TEV8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MWASCCNWFCLDGQPEEAPPPQGARTQAYSNPGYSSFPSPTGSEPSCKAC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001158043

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ARF6 protein (His tag)
PDEH101094-01 20 µg

Recombinant Human ARF6 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ARF6 protein (His tag)
PDEH101094-02 100 µg

Recombinant Human ARF6 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ARF6 protein (His tag)
PDEH101094-03 500 µg

Recombinant Human ARF6 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ARF6 protein (His tag)
PDEH101094-04 1 mg

Recombinant Human ARF6 protein (His tag)

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032G-02 100 Tests

PE/Cyanine5 Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details