Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ube2g1 Rabbit Polyclonal Antibody (HRP)

Ube2g1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI256795, AU014992, AW552068, 2700059C12Rik, D130023C12Rik

UniProt

P62254

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080261

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Burkholderia vietnamiensis Threonine--tRNA ligase (thrS), partial
MBS1080848 Inquire

Recombinant Burkholderia vietnamiensis Threonine--tRNA ligase (thrS), partial

Sign In for Pricing
View Details
Recombinant Mouse Claudin-4 (Cldn4)
orb2918274-01 20 µg

Recombinant Mouse Claudin-4 (Cldn4)

Sign In for Pricing
View Details
Recombinant Mouse Claudin-4 (Cldn4)
orb2918274-02 100 µg

Recombinant Mouse Claudin-4 (Cldn4)

Sign In for Pricing
View Details
DEF8 CRISPR Activation Plasmid (m2)
sc-423864-ACT-2 20 µg

DEF8 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Recombinant CD46 Protein (Cys 35-Asp 328) [His]
VAng-1322Lsx-1mg 1 mg

Recombinant CD46 Protein (Cys 35-Asp 328) [His]

Sign In for Pricing
View Details
CDC26 sgRNA CRISPR Lentivector (Human) (Target 1)
K0411002 1.0 µg DNA

CDC26 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details