Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Claudin-4 (Cldn4)

This Recombinant Mouse Claudin-4 (Cldn4) spans the amino acid sequence from region 1-210.

Product Specifications

Product Name Alternative

Claudin-4, Clostridium perfringens enterotoxin receptor, CPE-R, CPE-receptor

UniProt

O35054

Expression Region

1-210

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASMGLQVLGISLAVLGWLGIILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTG QMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKIMIT AGAVFIVASMLIMVPVSWTAHNVIRDFYNPMVASGQKREMGASLYVGWAASGLLLLGGGL LCCSCPPRSNDKPYSAKYSAARSVPASNYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDA-MB-436 Cell Line
RWT-614 1x 10^6

MDA-MB-436 Cell Line

Sign In for Pricing
View Details
Rabbit Monoclonal S100A13 Antibody (184) [PerCP]
NBP2-89547PCP 0.1 mL

Rabbit Monoclonal S100A13 Antibody (184) [PerCP]

Sign In for Pricing
View Details
LOC367830 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7340903 1.0 µg DNA

LOC367830 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
RPL8 3'UTR GFP Stable Cell Line
TU070623 1.0 mL

RPL8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
4-Methyl-6- (trifluoromethyl) pyrimidine-2-carboxylic acid
EFC31304-01 50 mg

4-Methyl-6- (trifluoromethyl) pyrimidine-2-carboxylic acid

Sign In for Pricing
View Details
4-Methyl-6- (trifluoromethyl) pyrimidine-2-carboxylic acid
EFC31304-02 0.5 g

4-Methyl-6- (trifluoromethyl) pyrimidine-2-carboxylic acid

Sign In for Pricing
View Details