Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CGRRF1 Rabbit Polyclonal Antibody (Biotin)

CGRRF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CGR19, RNF197

UniProt

Q99675

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CGRRF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006559

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLASP1 (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) (MaxLight 550)
125026-ML550 100 µL

CLASP1 (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit Acidic mammalian chitinase (CHIA) ELISA Kit
MBS7209373-01 48 Well

Rabbit Acidic mammalian chitinase (CHIA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Acidic mammalian chitinase (CHIA) ELISA Kit
MBS7209373-02 96 Well

Rabbit Acidic mammalian chitinase (CHIA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Acidic mammalian chitinase (CHIA) ELISA Kit
MBS7209373-03 5x 96 Well

Rabbit Acidic mammalian chitinase (CHIA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Acidic mammalian chitinase (CHIA) ELISA Kit
MBS7209373-04 10x 96 Well

Rabbit Acidic mammalian chitinase (CHIA) ELISA Kit

Sign In for Pricing
View Details
Maleimide Activated Alkaline Phosphatase
M1242-1 1 mg

Maleimide Activated Alkaline Phosphatase

Sign In for Pricing
View Details