Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM42 Rabbit Polyclonal Antibody (HRP)

TRIM42 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

T4A1, PPP1R40

UniProt

Q8IWZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM42

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689829

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galectin 9 Recombinant Rabbit monoclonal Antibody
HA750810 100 µL

Galectin 9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HSF1 Human Gene Knockout Kit (CRISPR)
KN200314LP 1 Kit

HSF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Annexin A3 Mouse Monoclonal Antibody [A1F7]
EM1901-73 100 µL

Annexin A3 Mouse Monoclonal Antibody [A1F7]

Sign In for Pricing
View Details
PCTAIRE2 (CDK17) (NM_002595) Human Over-expression Lysate
LC400928 20 µg

PCTAIRE2 (CDK17) (NM_002595) Human Over-expression Lysate

Sign In for Pricing
View Details
Orexin Receptor 1 (HCRTR1) Human Gene Knockout Kit (CRISPR)
KN210381 1 Kit

Orexin Receptor 1 (HCRTR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
delta Sarcoglycan Recombinant Rabbit Monoclonal Antibody [JM61-10]
ET1703-88 100 µL

delta Sarcoglycan Recombinant Rabbit Monoclonal Antibody [JM61-10]

Sign In for Pricing
View Details