Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secreted and transmembrane protein 1 (SECTM1), partial

Product Specifications

Product Name Alternative

(Protein K-12)

Abbreviation

Recombinant Human SECTM1 protein, partial

Gene Name

SECTM1

UniProt

Q8WVN6

Expression Region

29-145aa

Organism

Homo sapiens (Human)

Target Sequence

QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

May be involved in thymocyte signaling.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.8 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp2ca (NM_019411) Mouse Tagged ORF Clone
MG204384 10 µg

Ppp2ca (NM_019411) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human ENO4 knockdown cell line
ABC-KD4791 1 Vial

Human ENO4 knockdown cell line

Sign In for Pricing
View Details
Noxa (PMAIP1) (NM_021127) Human Recombinant Protein
TP302071L 1 mg

Noxa (PMAIP1) (NM_021127) Human Recombinant Protein

Sign In for Pricing
View Details
Goat Factor 8 Coagulant (F8C) ELISA Kit
MBS9398941 Inquire

Goat Factor 8 Coagulant (F8C) ELISA Kit

Sign In for Pricing
View Details
Osteocalcin Monoclonal Antibody, RBITC Conjugated
bsm-25439M-RBITC 100 µL

Osteocalcin Monoclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Human C6 Matched Antibody Pair Set [ABP-S-02452]
ABP-S-02452 5 Plates

Human C6 Matched Antibody Pair Set [ABP-S-02452]

Sign In for Pricing
View Details