Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secreted and transmembrane protein 1 (SECTM1), partial

Product Specifications

Product Name Alternative

(Protein K-12)

Abbreviation

Recombinant Human SECTM1 protein, partial

Gene Name

SECTM1

UniProt

Q8WVN6

Expression Region

29-145aa

Organism

Homo sapiens (Human)

Target Sequence

QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

May be involved in thymocyte signaling.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.8 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMM8A (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 A, Deafness Dystonia Protein 1, X-linked Deafness Dystonia Protein, DDP, DDP1, TIM8A) (PE)
134451-PE 100 µL

TIMM8A (Mitochondrial Import Inner Membrane Translocase Subunit Tim8 A, Deafness Dystonia Protein 1, X-linked Deafness Dystonia Protein, DDP, DDP1, TIM8A) (PE)

Sign In for Pricing
View Details
N-WASP Antibody
bs-70728R 100 µL

N-WASP Antibody

Sign In for Pricing
View Details
C19orf47 Protein Vector (Human) (pPB-His-MBP)
PV329622 500 ng

C19orf47 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Human CD26/DPP4  ELISA Kit
LF-EK50880 1×96T

Human CD26/DPP4 ELISA Kit

Sign In for Pricing
View Details
DNMT2 Adenovirus (Human)
56602051 250 µL

DNMT2 Adenovirus (Human)

Sign In for Pricing
View Details
CRCP protein (His tag)
80R-1953 100 ug

CRCP protein (His tag)

Sign In for Pricing
View Details