Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A16 Rabbit Polyclonal Antibody (HRP)

SLC25A16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GDA, GDC, ML7, hML7, HGT.1, D10S105E

UniProt

P16260

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC25A16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxytocin R Polyclonal Antibody, APC Conjugated
bs-1314R-APC 100 µL

Oxytocin R Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
KRT85 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV634568 1.0 µg DNA

KRT85 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
MED1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
28287124 3x 1.0µg DNA

MED1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
RET Antibody / c-RET
V8277-100UG 100 µg

RET Antibody / c-RET

Sign In for Pricing
View Details
STF 2106-297*105-B7541 FF AC Signs
806990 Card of 1 Pictogram(s)

STF 2106-297*105-B7541 FF AC Signs

Sign In for Pricing
View Details
Lentiviral mouse Tmem62 shRNA (UAS) - Lentiviral mouse Tmem62 shRNA (UAS, RFP) (25)
GTR15219143 1 Vial

Lentiviral mouse Tmem62 shRNA (UAS) - Lentiviral mouse Tmem62 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details