Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYBA Rabbit Polyclonal Antibody (HRP)

CYBA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGD4, p22-PHOX

UniProt

P13498

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYBA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_000092

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Cyclophilin A Protein
PKSH033420-01 10 µg

Recombinant Human Cyclophilin A Protein

Sign In for Pricing
View Details
Recombinant Human Cyclophilin A Protein
PKSH033420-02 50 µg

Recombinant Human Cyclophilin A Protein

Sign In for Pricing
View Details
Recombinant Human IL36G/IL1F9 Protein
PKSH031852 50 µg

Recombinant Human IL36G/IL1F9 Protein

Sign In for Pricing
View Details
GF-1 Blood Starter Kit / Taq DNA Polymerase, 25 preps
GF-BD-K 25 Preparations

GF-1 Blood Starter Kit / Taq DNA Polymerase, 25 preps

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700237 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2463), CF647 conjugate, 0.1mg/mL
BNC472463-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2463), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details