Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT2 Rabbit Polyclonal Antibody (FITC)

B4GALT2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

B4Gal-T2, B4Gal-T3, beta4Gal-T2

UniProt

O60909

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human B4GALT2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005417

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Erythropoietin receptor (Epor), partial
orb1096166-01 20 µg

Recombinant Mouse Erythropoietin receptor (Epor), partial

Sign In for Pricing
View Details
Recombinant Mouse Erythropoietin receptor (Epor), partial
orb1096166-02 100 µg

Recombinant Mouse Erythropoietin receptor (Epor), partial

Sign In for Pricing
View Details
Recombinant Mouse Erythropoietin receptor (Epor), partial
orb1096166-03 1 mg

Recombinant Mouse Erythropoietin receptor (Epor), partial

Sign In for Pricing
View Details
Granzyme B (C11, Cathespin G Like 1, CCP1, CGL1, CSPB, CTLA1, CTSGL1, Cytotoxic serine protease B, Cytotoxic T Lymphocyte Cytotoxic T lymphocyte proteinase 2, EC 3.4.21.79, Fragmentin 2, Granzyme 2, GRB, GZMB, HLP, Human lymphocyte protein, Lymphocyte protease, Protease Serine B, SECT) discontinued
G8957-15J 100 µg

Granzyme B (C11, Cathespin G Like 1, CCP1, CGL1, CSPB, CTLA1, CTSGL1, Cytotoxic serine protease B, Cytotoxic T Lymphocyte Cytotoxic T lymphocyte proteinase 2, EC 3.4.21.79, Fragmentin 2, Granzyme 2, GRB, GZMB, HLP, Human lymphocyte protein, Lymphocyte protease, Protease Serine B, SECT) discontinued

Sign In for Pricing
View Details
Eotaxin 1 antibody
MBS834466 Inquire

Eotaxin 1 antibody

Sign In for Pricing
View Details
Human SMG5 qPCR Primer Pair
QH35597S 200 Tests

Human SMG5 qPCR Primer Pair

Sign In for Pricing
View Details