Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Erythropoietin receptor (Epor), partial

This Recombinant Mouse Erythropoietin receptor (Epor), partial spans the amino acid sequence from region 25-249aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPO-R

UniProt

P14753

Expression Region

25-249aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRM2 Polyclonal Antibody, Biotin Conjugated
A67785-050 50 µL

MRM2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
RTN4 Protein Vector (Human) (pPM-C-HA)
42869022 500 ng

RTN4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
MAP126 Rabbit Polyclonal Antibody (BF350)
orb1975084 100 µL

MAP126 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Octyl Salicylate
TRC-O297003-2.5G 2.5 g

Octyl Salicylate

Sign In for Pricing
View Details
β1 Tubulin CRISPR Activation Plasmid (m)
sc-436807-ACT 20 µg

β1 Tubulin CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Fatty Acid Binding Protein 2, Intestinal (FABP2)
MBS2090901-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Fatty Acid Binding Protein 2, Intestinal (FABP2)

Sign In for Pricing
View Details