Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dct Rabbit Polyclonal Antibody (Biotin)

Dct Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DT, TR, TRP, Tyr, slt, TRP2, Tyrp, TRP-2, Tyrp2, slaty, Tyrp-2

UniProt

P29812

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CPPLGPEATNICGFLEGRGQCAEVQTDTRPWSGPYILRNQDDREQWPRKF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCORL1 Protein Vector (Mouse) (pPM-C-HA)
13253024 500 ng

BCORL1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SIAHBP1, Control Peptide (Siah-binding Protein 1, Siah-BP1, 60kD Poly (U) -binding-splicing Factor, FUSE-binding Protein-interacting Repressor, FBP-interacting Repressor, FIR, FLJ31379, Poly-U binding Splicing Factor 60kDa, Poly (U) -binding-splicing Factor PUF60, PUF60, Ro-binding Protein 1, RoBP1, ROBPI)
147939 100 µg

SIAHBP1, Control Peptide (Siah-binding Protein 1, Siah-BP1, 60kD Poly (U) -binding-splicing Factor, FUSE-binding Protein-interacting Repressor, FBP-interacting Repressor, FIR, FLJ31379, Poly-U binding Splicing Factor 60kDa, Poly (U) -binding-splicing Factor PUF60, PUF60, Ro-binding Protein 1, RoBP1, ROBPI)

Sign In for Pricing
View Details
CSDC2 Rabbit Polyclonal Antibody (Biotin)
orb2124910 100 µL

CSDC2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
BLZF1 Rabbit Polyclonal Antibody (Biotin)
orb2135717 100 µL

BLZF1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
M/M032/NT/RLFBD-DIA400-1 Personal Protection (PPE) Signs (No Adhesive)
305766 1 Pack (1 Panel (s) x 1 Pack)

M/M032/NT/RLFBD-DIA400-1 Personal Protection (PPE) Signs (No Adhesive)

Sign In for Pricing
View Details
Guinea pig β Glucosidase ELISA Kit
NSL1149Gp 96 Tests

Guinea pig β Glucosidase ELISA Kit

Sign In for Pricing
View Details