Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSDC2 Rabbit Polyclonal Antibody (Biotin)

CSDC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PIPPIN, dJ347H13.2

UniProt

Q9Y534

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CSDC2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_055275

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD27 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated
CD27-638HAF488 20 μg- 50 μg- 100 μg

Recombinant Human CD27 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated

Sign In for Pricing
View Details
Human Tumor necrosis factor receptor-associated factor 6 (TRAF6) ELISA Kit
RK12312 96 Tests

Human Tumor necrosis factor receptor-associated factor 6 (TRAF6) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human HELZ shRNA (UAS) - Lentiviral human HELZ shRNA (UAS) (100)
GTR15157410 1 Vial

Lentiviral human HELZ shRNA (UAS) - Lentiviral human HELZ shRNA (UAS) (100)

Sign In for Pricing
View Details
Human Small Cell Lung Cancer Organoid Medium
O5150-01 100 mL

Human Small Cell Lung Cancer Organoid Medium

Sign In for Pricing
View Details
Human Small Cell Lung Cancer Organoid Medium
O5150-02 500 mL

Human Small Cell Lung Cancer Organoid Medium

Sign In for Pricing
View Details
Pcdh19 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6097004 1.0 µg DNA

Pcdh19 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details