Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRCH4 Rabbit Polyclonal Antibody (HRP)

LRCH4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LRN, LRRN1, LRRN4, PP14183

UniProt

O75427

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LRCH4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGHRYDGGLDSGFHSVDSGSKRWSGNESTDEFSELSFRISELAREPRGPR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002310

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STIM2 Rabbit Polyclonal Antibody
ER1901-04 100 µL

STIM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (rCR2/1952), CF740 conjugate, 0.1mg/mL
BNC743789-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (rCR2/1952), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acetaldehyde Ammonia Trimer
TRC-A132743-5G 5 g

Acetaldehyde Ammonia Trimer

Sign In for Pricing
View Details
Human TMEM179 activation kit by CRISPRa
GA117927 1 Kit

Human TMEM179 activation kit by CRISPRa

Sign In for Pricing
View Details
FAAH1 (FAAH) Human Gene Knockout Kit (CRISPR)
KN210331RB 1 Kit

FAAH1 (FAAH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF740 conjugate, 0.1mg/mL
BNC742243-500 1x 500 µL

Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details