Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP3 Rabbit Polyclonal Antibody (HRP)

LRP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LRP3

UniProt

O75074

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LRP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSAVPALAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002324

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nudt14 Rat shRNA Plasmid (Locus ID 299346)
TR705334 1 Kit

Nudt14 Rat shRNA Plasmid (Locus ID 299346)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A UPF0208 membrane protein YfbV (yfbV)
MBS7034390-01 0.02 mg

Recombinant Salmonella paratyphi A UPF0208 membrane protein YfbV (yfbV)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A UPF0208 membrane protein YfbV (yfbV)
MBS7034390-02 0.1 mg

Recombinant Salmonella paratyphi A UPF0208 membrane protein YfbV (yfbV)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A UPF0208 membrane protein YfbV (yfbV)
MBS7034390-03 5x 0.1 mg

Recombinant Salmonella paratyphi A UPF0208 membrane protein YfbV (yfbV)

Sign In for Pricing
View Details
XTP3TPA (DCTPP1) (NM_024096) Human 3' UTR Clone
SC207485 10 µg

XTP3TPA (DCTPP1) (NM_024096) Human 3' UTR Clone

Sign In for Pricing
View Details
TLK1 (N) Antibody, Rabbit Polyclonal
orb67284 100 µL

TLK1 (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details