Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC5C Rabbit Polyclonal Antibody (FITC)

UNC5C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

UNC5H3

UniProt

O95185

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human UNC5C

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFTSK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Aconitase 2 Antibody (OTI3G8) [Alexa Fluor 405]
NBP2-70074AF405 0.1 mL

Mouse Monoclonal Aconitase 2 Antibody (OTI3G8) [Alexa Fluor 405]

Sign In for Pricing
View Details
Anticancer agent 264
HY-170965 1 Each

Anticancer agent 264

Sign In for Pricing
View Details
Lentiviral human TRIB2 shRNA (UAS) - Lentiviral human TRIB2 shRNA (UAS, GFP) plasmid
GTR15110134 1 Vial

Lentiviral human TRIB2 shRNA (UAS) - Lentiviral human TRIB2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SKI2W, NT (Superkiller viralicidic activity 2-like, DDX13, Helicase-like protein, Helicase SKI2W, HLP, SKI2, SKIV2, SKIV2L)
352522 100 µg

SKI2W, NT (Superkiller viralicidic activity 2-like, DDX13, Helicase-like protein, Helicase SKI2W, HLP, SKI2, SKIV2, SKIV2L)

Sign In for Pricing
View Details
SIK3 3'UTR GFP Stable Cell Line
TU073205 1.0 mL

SIK3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
FITC Conjugated Goat Affinity Purified Antibody to Equine IgG
FAF-431-1 1 mL

FITC Conjugated Goat Affinity Purified Antibody to Equine IgG

Sign In for Pricing
View Details